PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c26_13600V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 297aa    MW: 33167.9 Da    PI: 6.427
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c26_13600V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.68.9e-161562148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+ Ed  l  ++k +G g+W++ +++ g+ R++k+c++rw++yl
  Pp3c26_13600V3.1.p 15 KGPWTEAEDTTLSAYIKAHGEGNWRLLPKCAGLSRCGKSCRLRWLNYL 62
                        79********************************************97 PP

2Myb_DNA-binding51.42.6e-1668113148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+++ +E++l+v ++++lG++ W++Ia +++ gRt++++k++w+++l
  Pp3c26_13600V3.1.p  68 KGKFSWDEEDLIVTLHALLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 113
                         79********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.4321062IPR017930Myb domain
SuperFamilySSF466897.99E-2913109IPR009057Homeodomain-like
SMARTSM007171.5E-121464IPR001005SANT/Myb domain
PfamPF002495.8E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-211669IPR009057Homeodomain-like
CDDcd001674.15E-101762No hitNo description
PROSITE profilePS5129425.91563117IPR017930Myb domain
SMARTSM007173.3E-1567115IPR001005SANT/Myb domain
PfamPF002494.2E-1568113IPR001005SANT/Myb domain
CDDcd001671.65E-1170113No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2470117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGRSQCSKGE GGIYKGPWTE AEDTTLSAYI KAHGEGNWRL LPKCAGLSRC GKSCRLRWLN  60
YLRPGLKKGK FSWDEEDLIV TLHALLGNRW SLIAGRIPGR TDNEIKNYWN THLSRKLRNK  120
GIDPCDHKVG QLTLNSKYTV DRSNSELYAG EFIHQQPTTS AEKCTTTSSP AYSKHHSPAD  180
DYEHLALPPV KRIPPVQGKT ISSPNLSYPT YSISDGSNSS GEDEYLCPYG QLCCMDWISA  240
SDNHVLECPP DRSHHYSVEQ QNPVFNADMS TLSISDFDCL DFDIKEFQDD AANSDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25131175108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S6_416V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-60myb domain protein 4